ARG58758

anti-NR5A1 antibody

anti-NR5A1 antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes NR5A1
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Sheep
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name NR5A1
Antigen Species Human
Immunogen Synthetic peptide around the middle region of Human NR5A1. (within the following sequence: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP)
Conjugation Un-conjugated
Alternate Names SRXY3; Nuclear receptor subfamily 5 group A member 1; POF7; SF-1; SPGF8; FTZ1; FTZF1; SF1; Steroid hormone receptor Ad4BP; Fushi tarazu factor homolog 1; AD4BP; Adrenal 4-binding protein; ELP; Steroidogenic factor 1; STF-1

Application Instructions

Predict Reactivity Note Predicted homology based on immunogen sequence: Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Mouse: 79%; Rabbit: 85%; Rat: 92%; Sheep: 85%
Application Suggestion
Tested Application Dilution
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control HepG2

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2516 Human NR5A1

Swiss-port # Q13285 Human Steroidogenic factor 1

Gene Symbol NR5A1
Gene Full Name nuclear receptor subfamily 5, group A, member 1
Background The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. [provided by RefSeq, Jul 2008]
Function Transcriptional activator. Seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. Binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. Binds phosphatidylcholine (By similarity). Binds phospholipids with a phosphatidylinositol (PI) headgroup, in particular PI(3,4)P2 and PI(3,4,5)P3. Activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation. [UniProt]
Calculated MW 52 kDa
PTM Acetylation stimulates the transcriptional activity.

Sumoylation reduces CDK7-mediated phosphorylation on Ser-203.

Phosphorylated on Ser-203 by CDK7. This phosphorylation promotes transcriptional activity. [UniProt]

Images (1) Click the Picture to Zoom In

  • ARG58758 anti-NR5A1 / SF1 antibody WB image

    Western blot: HepG2 cell lysate stained with ARG58758 anti-NR5A1 / SF1 antibody at  0.2 - 1 µg/ml dilution.