ARG40516
anti-NUCB1 / Nucleobindin 1 antibody
anti-NUCB1 / Nucleobindin 1 antibody for IHC-Formalin-fixed paraffin-embedded sections and Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes NUCB1 / Nucleobindin 1 |
|---|---|
| Tested Reactivity | Rat |
| Predict Reactivity | Ms, Dog |
| Tested Application | IHC-P |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | NUCB1 / Nucleobindin 1 |
| Antigen Species | Rat |
| Immunogen | Synthetic peptide corresponding to a region of Rat NUCB1 / Nucleobindin 1. (within the following region: SQPDGQLQFRADTGDAPVPAPAGDQKDVPASEKKVPEQPPVLPQLDSQHL) |
| Conjugation | Un-conjugated |
| Alternate Names | CALNUC; NUC; Nucleobindin-1 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Dog: 78%; Mouse: 92% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Purification with Protein A. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | NUCB1 |
| Gene Full Name | nucleobindin 1 |
| Background | This gene encodes a member of a small calcium-binding EF-hand protein family. The encoded protein is thought to have a key role in Golgi calcium homeostasis and Ca(2+)-regulated signal transduction events. [provided by RefSeq, Jun 2010] |
| Function | Major calcium-binding protein of the Golgi. May have a role in calcium homeostasis (By similarity). [UniProt] |
| Cellular Localization | Golgi apparatus, cis-Golgi network membrane; Peripheral membrane protein; Lumenal side. Cytoplasm. Secreted. Note=A small fraction of the protein may be cytoplasmic. [UniProt] |
| Calculated MW | 54 kDa |
| PTM | O-glycosylated. [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG40516 anti-NUCB1 / Nucleobindin 1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded sections of Rat NRK stained with ARG40516 anti-NUCB1 / Nucleobindin 1 antibody.
