ARG40720
anti-OAT3 / SLC22A8 antibody
anti-OAT3 / SLC22A8 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes OAT3 / SLC22A8 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Cow, Dog, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | OAT3 / SLC22A8 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human OAT3 / SLC22A8. (within the following region: PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS) |
| Conjugation | Un-conjugated |
| Alternate Names | Organic anion transporter 3; Solute carrier family 22 member 8; hOAT3; OAT3 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 79%; Dog: 79%; Mouse: 86%; Rabbit: 86% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human heart | ||||
| Observed Size | 65 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SLC22A8 |
| Gene Full Name | solute carrier family 22 (organic anion transporter), member 8 |
| Background | This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, May 2010] |
| Function | Plays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone-3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA). [UniProt] |
| Cellular Localization | Basolateral cell membrane; Multi-pass membrane protein. Note=Localizes on the brush border membrane of the choroid epithelial cells. Localizes to the basolateral membrane of the proximal tubular cells. Localizes on the abluminal and possibly, luminal membrane of the brain capillary endothelial cells (BCEC) (By similarity). [UniProt] |
| Calculated MW | 60 kDa |
Images (1) Click the Picture to Zoom In
