ARG58840
anti-OPN / Osteopontin antibody
anti-OPN / Osteopontin antibody for Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes OPN / Osteopontin |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | OPN / Osteopontin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 281-314 of Human Osteopontin (HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN). |
| Conjugation | Un-conjugated |
| Alternate Names | BSPI; ETA-1; Uropontin; Osteopontin; Nephropontin; SPP-1; Bone sialoprotein 1; BNSP; Urinary stone protein; OPN; Secreted phosphoprotein 1 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SPP1 |
| Gene Full Name | secreted phosphoprotein 1 |
| Background | The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Function | Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Acts as a cytokine involved in enhancing production of interferon-gamma and interleukin-12 and reducing production of interleukin-10 and is essential in the pathway that leads to type I immunity. [UniProt] |
| Cellular Localization | Secreted. [UniProt] |
| Highlight | Related products: OPN antibodies; OPN ELISA Kits; Anti-Rabbit IgG secondary antibodies; Related news: The role of HDGF in tumor angiogenesis |
| Calculated MW | 35 kDa |
| PTM | Extensively phosphorylated by FAM20C in the extracellular medium at multiple sites within the S-x-E/pS motif. N- and O-glycosylated. Isoform 5 is GalNAc O-glycosylated at Thr-59 or Ser-62. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG58840 anti-OPN / Osteopontin antibody WB image
Western blot: 50 µg of Mouse brain lysates (both two lanes) under reducing conditions. The blots were stained with ARG58840 anti-OPN / Osteopontin antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG58840 anti-OPN / Osteopontin antibody WB image
Western blot: 50 µg of sample under reducing conditions. Rat brain, Mouse brain and SHG-44 whole cell lysates stained with ARG58840 anti-OPN / Osteopontin antibody at 0.5 µg/ml dilution, overnight at 4°C.
