ARG41264
anti-OVOL2 antibody
anti-OVOL2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes OVOL2 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Cow, Dog, Hrs |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | OVOL2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human OVOL2. (within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG) |
| Conjugation | Un-conjugated |
| Alternate Names | Zinc finger protein 339; EUROIMAGE566589; Transcription factor Ovo-like 2; hOvo2; ZNF339 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Mouse: 93% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | WB: 721_B cell IHC: Human Corneal Endothelium |
||||||
| Observed Size | 31 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | OVOL2 |
| Gene Full Name | ovo-like zinc finger 2 |
| Function | Zinc-finger transcription repressor factor. Plays a critical role to maintain the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition mainly through the up-regulation of ZEB1 expression. Positively regulates neuronal differentiation (By similarity). Suppresses cell cycling and terminal differentiation of keratinocytes by directly repressing MYC and NOTCH1. [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 30 kDa |
Images (2) Click the Picture to Zoom In
-
ARG41264 anti-OVOL2 antibody IHC image
Immunohistochemistry: Human corneal epithelium stained with ARG41264 anti-OVOL2 antibody at 1:250 dilution.
-
ARG41264 anti-OVOL2 antibody WB image
Western blot: 721_B cell lysate stained with ARG41264 anti-OVOL2 antibody at 0.2 - 1 µg/ml dilution.
