ARG41264
anti-OVOL2 antibody
anti-OVOL2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes OVOL2 |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Cow, Dog, Hrs |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | OVOL2 |
Antigen Species | Human |
Immunogen | Synthetic peptide around the N-terminal region of Human OVOL2. (within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG) |
Conjugation | Un-conjugated |
Alternate Names | Zinc finger protein 339; EUROIMAGE566589; Transcription factor Ovo-like 2; hOvo2; ZNF339 |
Application Instructions
Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Mouse: 93% | ||||||
---|---|---|---|---|---|---|---|
Application Suggestion |
|
||||||
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
Positive Control | WB: 721_B cell IHC: Human Corneal Endothelium |
||||||
Observed Size | 31 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purified. |
Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
Preservative | 0.09% (w/v) Sodium azide |
Stabilizer | 2% Sucrose |
Concentration | Batch dependent: 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | OVOL2 |
Gene Full Name | ovo-like zinc finger 2 |
Function | Zinc-finger transcription repressor factor. Plays a critical role to maintain the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition mainly through the up-regulation of ZEB1 expression. Positively regulates neuronal differentiation (By similarity). Suppresses cell cycling and terminal differentiation of keratinocytes by directly repressing MYC and NOTCH1. [UniProt] |
Cellular Localization | Nucleus. [UniProt] |
Calculated MW | 30 kDa |
Images (2) Click the Picture to Zoom In