ARG41264

anti-OVOL2 antibody

anti-OVOL2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes OVOL2
Tested Reactivity Hu
Predict Reactivity Ms, Cow, Dog, Hrs
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name OVOL2
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human OVOL2. (within the following region: PKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDG)
Conjugation Un-conjugated
Alternate Names Zinc finger protein 339; EUROIMAGE566589; Transcription factor Ovo-like 2; hOvo2; ZNF339

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Mouse: 93%
Application Suggestion
Tested Application Dilution
IHC-P1:250
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control WB: 721_B cell
IHC: Human Corneal Endothelium
Observed Size 31 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 58495 Human OVOL2

Swiss-port # Q9BRP0 Human Transcription factor Ovo-like 2

Gene Symbol OVOL2
Gene Full Name ovo-like zinc finger 2
Function Zinc-finger transcription repressor factor. Plays a critical role to maintain the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition mainly through the up-regulation of ZEB1 expression. Positively regulates neuronal differentiation (By similarity). Suppresses cell cycling and terminal differentiation of keratinocytes by directly repressing MYC and NOTCH1. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 30 kDa

Images (2) Click the Picture to Zoom In

  • ARG41264 anti-OVOL2 antibody IHC image

    Immunohistochemistry: Human corneal epithelium stained with ARG41264 anti-OVOL2 antibody at 1:250 dilution.

  • ARG41264 anti-OVOL2 antibody WB image

    Western blot: 721_B cell lysate stained with ARG41264 anti-OVOL2 antibody at 0.2 - 1 µg/ml dilution.