ARG40850
anti-PGM5 antibody
anti-PGM5 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes PGM5 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | PGM5 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the C-terminal region of Human PGM5 (within the following region: FRLSSSSGVRATLRLYAESYERDPSGHDQEPQAVLSPLIAIALKISQIHE). |
| Conjugation | Un-conjugated |
| Alternate Names | Phosphoglucomutase-like protein 5; PGMRP; PGM-RP; Aciculin; Phosphoglucomutase-related protein |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | PGM5 |
| Gene Full Name | phosphoglucomutase 5 |
| Background | Phosphoglucomutases (EC 5.2.2.2.), such as PGM5, are phosphotransferases involved in interconversion of glucose-1-phosphate and glucose-6-phosphate. PGM activity is essential in formation of carbohydrates from glucose-6-phosphate and in formation of glucose-6-phosphate from galactose and glycogen (Edwards et al., 1995 [PubMed 8586438]).[supplied by OMIM, Mar 2008] |
| Function | Component of adherens-type cell-cell and cell-matrix junctions. Lacks phosphoglucomutase activity. [UniProt] |
| Cellular Localization | Cell junction, adherens junction. Cytoplasm, cytoskeleton. Note=Adherens-type cellular junctions. Concentrated in focal contacts at the ends of actin bundles, and associated with actin filaments. [UniProt] |
| Calculated MW | 62 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40850 anti-PGM5 antibody WB image
Western blot: Human ACHN whole cell lysate stained with ARG40850 anti-PGM5 antibody at 1 µg/ml dilution.
