ARG59040

anti-RAB13 antibody

anti-RAB13 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes RAB13
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Hm
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name RAB13
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 121-150 of Human RAB13 (NKCDMEAKRKVQKEQADKLAREHGIRFFET).
Conjugation Un-conjugated
Alternate Names Cell growth-inhibiting gene 4 protein; GIG4; Ras-related protein Rab-13

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 5872 Human RAB13

GeneID: 68328 Mouse RAB13

GeneID: 81756 Rat RAB13

Gene Symbol RAB13
Gene Full Name RAB13, member RAS oncogene family
Background This gene is a member of the Rab family of small G proteins and plays a role in regulating membrane trafficking between trans-Golgi network (TGN) and recycling endosomes (RE). The encoded protein is involved in the assembly of tight junctions, which are components of the apical junctional complex (AJC) of epithelial cells. The AJC plays a role in forming a barrier between luminal contents and the underlying tissue. Additional functions associated with the protein include endocytic recycling of occludin, regulation of epithelial cell scattering, neuronal regeneration and regulation of neurite outgrowth. Alternately spliced transcript variants have been observed for this gene. A pseudogene associated with this gene is located on chromosome 12. [provided by RefSeq, Jan 2013]
Function The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in endocytic recycling and regulates the transport to the plasma membrane of transmembrane proteins like the tight junction protein OCLN/occludin. Thereby, it regulates the assembly and the activity of tight junctions. Moreover, it may also regulate tight junction assembly by activating the PKA signaling pathway and by reorganizing the actin cytoskeleton through the activation of the downstream effectors PRKACA and MICALL2 respectively. Through its role in tight junction assembly, may play a role in the establishment of Sertoli cell barrier. Plays also a role in angiogenesis through regulation of endothelial cells chemotaxis. Also involved in neurite outgrowth. Has also been proposed to play a role in post-Golgi membrane trafficking from the TGN to the recycling endosome. Finally, it has been involved in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore may play a role in glucose homeostasis. [UniProt]
Cellular Localization Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle membrane; Lipid- anchor; Cytoplasmic side. Cell junction, tight junction. Golgi apparatus, trans-Golgi network membrane. Recycling endosome membrane. Cell projection, lamellipodium. Tight junctions or associated with vesicles scattered throughout the cytoplasm in cells lacking tight junctions (PubMed:8294494). Relocalizes to the leading edge of lamellipodia in migrating endothelial cells (By similarity). [UniProt]
Calculated MW 23 kDa

Images (3) Click the Picture to Zoom In

  • ARG59040 anti-RAB13 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse intestine tissue stained with ARG59040 anti-RAB13 antibody.

  • ARG59040 anti-RAB13 antibody WB image

    Western blot: 50 µg of Rat kidney, 40 µg of HeLa and 40 µg of HepG2 lysates stained with ARG59040 anti-RAB13 antibody at 0.5 µg/ml dilution.

  • ARG59040 anti-RAB13 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Rat intestine tissue stained with ARG59040 anti-RAB13 antibody.