ARG42601
anti-RAB1A antibody
anti-RAB1A antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes RAB1A |
|---|---|
| Tested Reactivity | Hu, Ms |
| Predict Reactivity | Cow, Rat, Dog, Goat, Gpig, Hrs, Rb, Zfsh |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | RAB1A |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the center region of Human RAB1A. (within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC) |
| Conjugation | Un-conjugated |
| Alternate Names | RAB1; YPT1-related protein; YPT1; Ras-related protein Rab-1A |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea pig: 100%; Horse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | Human muscle and Mouse kidney | ||||||
| Observed Size | ~ 28 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | RAB1A |
| Gene Full Name | RAB1A, member RAS oncogene family |
| Background | This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms. [provided by RefSeq, Oct 2008] |
| Function | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport. [UniProt] |
| Cellular Localization | Golgi apparatus. Endoplasmic reticulum. Early endosome. Cytoplasm, cytosol. Membrane. Melanosome. Note=Alternates between membrane-associated and cytosolic forms. [UniProt] |
| Calculated MW | 23 kDa |
| PTM | Phosphorylated by CDK1 kinase during mitosis. Phosphocholinated at Ser-79 by L.pneumophila AnkX, leading to displace GDP dissociation inhibitors (GDI). Both GDP-bound and GTP-bound forms can be phosphocholinated. Dephosphocholinated by L.pneumophila Lem3, restoring accessibility to L.pneumophila GTPase effector LepB. [UniProt] |
Images (3) Click the Picture to Zoom In
-
ARG42601 anti-RAB1A antibody IHC-P image
Immunohistochemistry: Formalin-fixed and paraffin-embedded Human bronchial epithelial tissue stained with ARG42601 anti-RAB1A antibody (green) at 1:100 dilution.
-
ARG42601 anti-RAB1A antibody WB image
Western blot: Human muscle lysate stained with ARG42601 anti-RAB1A antibody at 0.2 - 1 µg/ml dilution.
-
ARG42601 anti-RAB1A antibody WB image
Western blot: Mouse kidney lysate stained with ARG42601 anti-RAB1A antibody at 1 µg/ml dilution.
