ARG59132

anti-RRM2 antibody

anti-RRM2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes RRM2
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name RRM2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 1-33 of Human RRM2. (MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT)
Conjugation Un-conjugated
Alternate Names R2; EC 1.17.4.1; Ribonucleoside-diphosphate reductase subunit M2; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; RR2M; RR2

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 20135 Mouse RRM2

GeneID: 362720 Rat RRM2

GeneID: 6241 Human RRM2

Gene Symbol RRM2
Gene Full Name ribonucleotide reductase M2
Background This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms that differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X. [provided by RefSeq, Sep 2009]
Function Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. Inhibits Wnt signaling. [UniProt]
Cellular Localization Cytoplasm. [UniProt]
Calculated MW 45 kDa
PTM Phosphorylation on Ser-20 relieves the inhibitory effect on Wnt signaling. [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG59132 anti-RRM2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human mammary cancer stained with ARG59132 anti-RRM2 antibody.

  • ARG59132 anti-RRM2 antibody WB image

    Western blot: 50 µg of Rat cardiac muscle, 50 µg of Mouse cardiac muscle, 40 µg of A431 and 40 µg of HeLa lysates stained with ARG59132 anti-RRM2 antibody at 0.5 µg/ml dilution.