ARG41303
anti-Recoverin antibody
anti-Recoverin antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Recoverin |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Recoverin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human Recoverin. (within the following region: GNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQS) |
| Conjugation | Un-conjugated |
| Alternate Names | Recoverin; Cancer-associated retinopathy protein; RCV1; Protein CAR |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 93%; Horse: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human placenta | ||||
| Observed Size | 23 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | RCVRN |
| Gene Full Name | recoverin |
| Background | This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq, Jul 2008] |
| Function | Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse. [UniProt] |
| Calculated MW | 23 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41303 anti-Recoverin antibody WB image
Western blot: Human placenta lysate stained with ARG41303 anti-Recoverin antibody at 0.2 - 1 µg/ml dilution.
