ARG40274
anti-SLC13A5 antibody
anti-SLC13A5 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SLC13A5 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SLC13A5 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human SLC13A5. (within the following region: CKAMTLCICYAASIGGTATLTGTGPNVVLLGQMNELFPDSKDLVNFASWF) |
| Conjugation | Un-conjugated |
| Alternate Names | Solute carrier family 13 member 5; mIndy; EIEE25; Na; NACT; Sodium-dependent citrate transporter; NaCT; Sodium-coupled citrate transporter |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 92%; Dog: 85%; Guinea pig: 100%; Horse: 85%; Mouse: 77%; Rabbit: 100%; Rat: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Observed Size | ~ 53 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SLC13A5 |
| Gene Full Name | solute carrier family 13 (sodium-dependent citrate transporter), member 5 |
| Background | This gene encodes a protein belonging to the solute carrier family 13 group of proteins. This family member is a sodium-dependent citrate cotransporter that may regulate metabolic processes. Mutations in this gene cause early infantile epileptic encephalopathy 25. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014] |
| Function | High-affinity sodium/citrate cotransporter that mediates citrate entry into cells. The transport process is electrogenic; it is the trivalent form of citrate rather than the divalent form that is recognized as a substrate. May facilitate the utilization of circulating citrate for the generation of metabolic energy and for the synthesis of fatty acids and cholesterol. [UniProt] |
| Cellular Localization | Membrane; Multi-pass membrane protein. Cell membrane. [UniProt] |
| Calculated MW | 63 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40274 anti-SLC13A5 antibody WB image
Western blot: Human thymus tumor lysate stained with ARG40274 anti-SLC13A5 antibody at 1 µg/ml dilution.
