ARG59013
anti-SLC26A4 antibody
anti-SLC26A4 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SLC26A4 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SLC26A4 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human SLC26A4 (RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ). |
| Conjugation | Un-conjugated |
| Alternate Names | DFNB4; EVA; PDS; Pendrin; Solute carrier family 26 member 4; TDH2B; Sodium-independent chloride/iodide transporter |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SLC26A4 |
| Gene Full Name | solute carrier family 26 (anion exchanger), member 4 |
| Background | Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. [provided by RefSeq, Jul 2008] |
| Function | Sodium-independent transporter of chloride and iodide. [UniProt] |
| Cellular Localization | Membrane; Localizes to the apical brush border of cells in the cortical collecting ducts of the kidney. [UniProt] |
| Calculated MW | 86 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59013 anti-SLC26A4 antibody WB image
Western blot: 50 µg of samples under reducing conditions. HK-2 and 293T cell lysates stained with ARG59013 anti-SLC26A4 antibody at 0.5 µg/ml, overnight at 4°C.
