ARG59440
anti-SLC7A3 / CAT3 antibody
anti-SLC7A3 / CAT3 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SLC7A3 / CAT3 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SLC7A3 / CAT3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 1-30 of Human SLC7A3 / CAT3. (MPWQAFRRFGQKLVRRRTLESGMAETRLAR) |
| Conjugation | Un-conjugated |
| Alternate Names | ATRC3; Cationic amino acid transporter y+; Solute carrier family 7 member 3; CAT-3; Cationic amino acid transporter 3; CAT3 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SLC7A3 |
| Gene Full Name | solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 |
| Background | This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein.[provided by RefSeq, May 2010] |
| Function | Mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner. [UniProt] |
| Cellular Localization | Cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 67 kDa |
| PTM | N-glycosylated. [UniProt] |
Images (1) Click the Picture to Zoom In
