ARG59233

anti-SMC3 antibody [4C12]

anti-SMC3 antibody [4C12] for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Mouse Monoclonal antibody [4C12] recognizes SMC3
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Mouse
Clonality Monoclonal
Clone 4C12
Isotype IgG1
Target Name SMC3
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 1178-1216 of Human SMC3. (ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH)
Conjugation Un-conjugated
Alternate Names CDLS3; CSPG6; SMC3L1; SMC-3; Chromosome-associated polypeptide; BMH; Basement membrane-associated chondroitin proteoglycan; Structural maintenance of chromosomes protein 3; Bamacan; hCAP; Chondroitin sulfate proteoglycan 6; SMC protein 3; HCAP; BAM

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 13006 Mouse SMC3

GeneID: 9126 Human SMC3

Swiss-port # Q9CW03 Mouse Structural maintenance of chromosomes protein 3

Swiss-port # Q9UQE7 Human Structural maintenance of chromosomes protein 3

Gene Symbol SMC3
Gene Full Name structural maintenance of chromosomes 3
Background This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein. [provided by RefSeq, Jul 2008]
Function Central component of cohesin, a complex required for chromosome cohesion during the cell cycle. The cohesin complex may form a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. Cohesion is coupled to DNA replication and is involved in DNA repair. The cohesin complex plays also an important role in spindle pole assembly during mitosis and in chromosomes movement. [UniProt]
Cellular Localization Nucleus. Chromosome. Chromosome, centromere. Note=Associates with chromatin. [UniProt]
Calculated MW 142 kDa
PTM Phosphorylated at Ser-1083 in a SPO11-dependent manner.

Acetylation at Lys-105 and Lys-106 by ESCO1 is important for genome stability and S phase sister chromatid cohesion. Regulated by DSCC1, it is required for processive DNA synthesis, coupling sister chromatid cohesion establishment during S phase to DNA replication. Deacetylation by HDAC8, regulates release of the cohesin complex from chromatin. [UniProt]

Images (4) Click the Picture to Zoom In

  • ARG59233 anti-SMC3 antibody [4C12] IHC-P image

    Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59233 anti-SMC3 antibody [4C12] at 2 µg/ml dilution, overnight at 4°C.

  • ARG59233 anti-SMC3 antibody [4C12] WB image

    Western blot: 50 µg of samples under reducing conditions. HeLa, A549, MCF-7 and MDA-MB-453 whole cell lysates stained with ARG59233 anti-SMC3 antibody [4C12] at 0.5 µg/ml, overnight at 4°C.

  • ARG59233 anti-SMC3 antibody [4C12] WB image

    Western blot: 50 µg of sample under reducing conditions. HEK293, HeLa, Rat thymus and Mouse thymus lysates stained with ARG59233 anti-SMC3 antibody [4C12] at 0.5 µg/ml dilution, overnight at 4°C.

  • ARG59233 anti-SMC3 antibody [4C12] IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG59233 anti-SMC3 antibody [4C12] at 2 µg/ml dilution, overnight at 4°C.