ARG59550
anti-SP5 antibody
anti-SP5 antibody for IHC-Formalin-fixed paraffin-embedded sections and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SP5 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Hm |
| Tested Application | IHC-P |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SP5 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 246-275 of Human SP5. (DFAQYQSQIAALLQTKAPLAATARRCRRCR) |
| Conjugation | Un-conjugated |
| Alternate Names | Transcription factor Sp5 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SP5 |
| Gene Full Name | Sp5 transcription factor |
| Function | Binds to GC boxes promoters elements. Probable transcriptional activator that has a role in the coordination of changes in transcription required to generate pattern in the developing embryo (By similarity). [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 42 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59550 anti-SP5 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human placenta stained with ARG59550 anti-SP5 antibody.
