ARG59439
anti-SP6 antibody
anti-SP6 antibody for Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SP6 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SP6 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human SP6. (QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH) |
| Conjugation | Un-conjugated |
| Alternate Names | Transcription factor Sp6; EPIPROFIN; EPFN; Krueppel-like factor 14; KLF14 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SP6 |
| Gene Full Name | Sp6 transcription factor |
| Background | SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes (Scohy et al., 2000 [PubMed 11087666]).[supplied by OMIM, Mar 2008] |
| Function | Promotes cell proliferation. [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 40 kDa |
Images (1) Click the Picture to Zoom In
-
ARG59439 anti-SP6 antibody WB image
Western blot: 50 µg of samples under reducing conditions. Human placenta, MCF-7, Rat spleen and Mouse spleen lysates stained with ARG59439 anti-SP6 antibody at 0.5 µg/ml, overnight at 4°C.
