ARG42959
anti-SRI / Sorcin antibody
anti-SRI / Sorcin antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes SRI / Sorcin |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | FACS, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | SRI / Sorcin |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to a sequence of Human SRI / Sorcin. (TVDPQELQKALTTMGFRLSPQAVNSIAKRY) |
| Conjugation | Un-conjugated |
| Alternate Names | SCN; 22 kDa protein; V19; CP-22; Sorcin; CP22 |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||||
| Observed Size | ~ 22 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | SRI |
| Gene Full Name | sorcin |
| Background | This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. [provided by RefSeq, Mar 2012] |
| Function | Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels. [UniProt] |
| Cellular Localization | Cytoplasm. Sarcoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Note=Relocates to the sarcoplasmic reticulum membrane in response to elevated calcium levels. [UniProt] |
| Calculated MW | 22 kDa |
Images (6) Click the Picture to Zoom In
-
ARG42959 anti-SRI / Sorcin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42959 anti-SRI / Sorcin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42959 anti-SRI / Sorcin antibody WB image
Western blot: 50 µg of sample under reducing conditions. Human placenta, U2OS, A431, PC-3, HL-60, K562, Caco-2, Rat lung and Mouse lung lysates stained with ARG42959 anti-SRI / Sorcin antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG42959 anti-SRI / Sorcin antibody FACS image
Flow Cytometry: SiHa cells were blocked with 10% normal goat serum and then stained with ARG42959 anti-SRI / Sorcin antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was Rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG42959 anti-SRI / Sorcin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human mammary cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42959 anti-SRI / Sorcin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42959 anti-SRI / Sorcin antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human lung cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42959 anti-SRI / Sorcin antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42959 anti-SRI / Sorcin antibody FACS image
Flow Cytometry: U2OS cells were blocked with 10% normal goat serum and then stained with ARG42959 anti-SRI / Sorcin antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was Rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
