ARG58376
anti-TBX20 antibody
anti-TBX20 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TBX20 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb, Zfsh |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TBX20 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human TBX20. (located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS) |
| Conjugation | Un-conjugated |
| Alternate Names | T-box protein 20; ASD4; T-box transcription factor TBX20 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Observed Size | ~ 49 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | TBX20 |
| Gene Full Name | T-box 20 |
| Background | This gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box, and they are transcription factors involved in the regulation of developmental processes. This gene is essential for heart development. Mutations in this gene are associated with diverse cardiac pathologies, including defects in septation, valvulogenesis and cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
| Function | Acts as a transcriptional activator and repressor required for cardiac development and may have key roles in the maintenance of functional and structural phenotypes in adult heart. [UniProt] |
| Calculated MW | 49 kDa |
Images (3) Click the Picture to Zoom In
-
ARG58376 anti-TBX20 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human kidney stained with ARG58376 anti-TBX20 antibody at 5 µg/ml dilution.
-
ARG58376 anti-TBX20 antibody WB image
Western blot: HepG2 cell lysate stained with ARG58376 anti-TBX20 antibody at 1 µg/ml dilution.
-
ARG58376 anti-TBX20 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human muscle stained with ARG58376 anti-TBX20 antibody.
