ARG59647
anti-TFIIH p52 antibody
anti-TFIIH p52 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TFIIH p52 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Goat, Gpig, Rb, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TFIIH p52 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the C-terminal region of Human TFIIH p52. (within the following region: LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS) |
| Conjugation | Un-conjugated |
| Alternate Names | General transcription factor IIH polypeptide 4; BTF2 p52; General transcription factor IIH subunit 4; TFB2; Basic transcription factor 2 52 kDa subunit; TFIIH; TFIIH basal transcription factor complex p52 subunit; P52 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 87% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Purification with Protein A. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q92759 Human General transcription factor IIH subunit 4 |
|---|---|
| Gene Symbol | GTF2H4 |
| Gene Full Name | general transcription factor IIH, polypeptide 4, 52kDa |
| Function | Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. [UniProt] |
| Cellular Localization | Nucleus. [UniProt] |
| Calculated MW | 52 kDa |
Images (2) Click the Picture to Zoom In
-
ARG59647 anti-TFIIH p52 antibody WB image
Western blot: HepG2 cell lysate stained with ARG59647 anti-TFIIH p52 antibody at 1 µg/ml dilution.
-
ARG59647 anti-TFIIH p52 antibody WB image
Western blot: Jurkat cell lysate stained with ARG59647 anti-TFIIH p52 antibody at 1.25 µg/ml dilution.
