ARG41699
anti-TRIM31 antibody
anti-TRIM31 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TRIM31 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TRIM31 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human TRIM31. (within the following region: HSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAAL) |
| Conjugation | Un-conjugated |
| Alternate Names | EC 6.3.2.-; E3 ubiquitin-protein ligase TRIM31; Tripartite motif-containing protein 31; RNF; HCGI; HCG1; C6orf13 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human small intestine | ||||
| Observed Size | ~ 48 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9BZY9 Human E3 ubiquitin-protein ligase TRIM31 |
|---|---|
| Gene Symbol | TRIM31 |
| Gene Full Name | tripartite motif containing 31 |
| Background | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to both the cytoplasm and the nucleus. Its function has not been identified. [provided by RefSeq, Jul 2008] |
| Function | Regulator of Src-induced anchorage independent cell growth (By similarity). May have E3 ubiquitin-protein ligase activity. [UniProt] |
| Cellular Localization | Cytoplasm. Mitochondrion. Note=Predominantly expressed in the cytoplasm but a fraction is associated with the mitochondria. [UniProt] |
| Calculated MW | 48 kDa |
| PTM | Auto-ubiquitinated (in vitro). [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG41699 anti-TRIM31 antibody WB image
Western blot: Human small intestine lysate stained with ARG41699 anti-TRIM31 antibody at 0.2 - 1 µg/ml dilution.
