ARG40722
anti-TRIM55 / MURF2 antibody
anti-TRIM55 / MURF2 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TRIM55 / MURF2 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TRIM55 / MURF2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the N-terminal region of Human TRIM55. (within the following region: SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQ) |
| Conjugation | Un-conjugated |
| Alternate Names | Muscle-specific RING finger protein 2; muRF2; MuRF-2; MURF-2; RNF29; MuRF2; RING finger protein 29; Tripartite motif-containing protein 55 |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% | ||||
|---|---|---|---|---|---|
| Application Suggestion |
|
||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human brain | ||||
| Observed Size | ~ 60 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9BYV6 Human Tripartite motif-containing protein 55 |
|---|---|
| Gene Symbol | TRIM55 |
| Gene Full Name | tripartite motif containing 55 |
| Background | The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
| Function | May regulate gene expression and protein turnover in muscle cells. [UniProt] |
| Cellular Localization | Cytoplasm. Nucleus. Note=Nuclear under atrophic conditions and upon mechanical signals. Localizes to the sarcomeric M-band in cardiomyocytes. Colocalizes in part with microtubules (By similarity). [UniProt] |
| Calculated MW | 60 kDa |
Images (1) Click the Picture to Zoom In
-
ARG40722 anti-TRIM55 / MURF2 antibody WB image
Western blot: Human brain lysate stained with ARG40722 anti-TRIM55 / MURF2 antibody at 0.2 - 1 µg/ml dilution.
