ARG59102
anti-TUB / Tubby protein homolog antibody
anti-TUB / Tubby protein homolog antibody for Flow cytometry,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes TUB / Tubby protein homolog |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | FACS, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | TUB / Tubby protein homolog |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 395-429 of Human TUB / Tubby protein homolog. (VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT) |
| Conjugation | Un-conjugated |
| Alternate Names | rd5; Tubby protein homolog; RDOB |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | TUB |
| Gene Full Name | tubby bipartite transcription factor |
| Background | This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Function | Functions in signal transduction from heterotrimeric G protein-coupled receptors. Binds to membranes containing phosphatidylinositol 4,5-bisphosphate. Can bind DNA (in vitro). May contribute to the regulation of transcription in the nucleus. Could be involved in the hypothalamic regulation of body weight (By similarity). Contribute to stimulation of phagocytosis of apoptotic retinal pigment epithelium (RPE) cells and macrophages. [UniProt] |
| Cellular Localization | Cytoplasm. Nucleus. Secreted. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note=Binds phospholipid and is anchored to the plasma membrane through binding phosphatidylinositol 4,5-bisphosphate. Is released upon activation of phospholipase C. Translocates from the plasma membrane to the nucleus upon activation of guanine nucleotide-binding protein G(q) subunit alpha. Does not have a cleavable signal peptide and is secreted by a non-conventional pathway (By similarity). [UniProt] |
| Calculated MW | 56 kDa |
Images (2) Click the Picture to Zoom In
-
ARG59102 anti-TUB / Tubby protein homolog antibody WB image
Western blot: COLO320 and MCF-7 cell lysates stained with ARG59102 anti-TUB / Tubby protein homolog antibody at 0.5 µg/ml dilution.
-
ARG59102 anti-TUB / Tubby protein homolog antibody FACS image
Flow Cytometry: HeLa cells were blocked with 10% normal goat serum and then stained with ARG59102 anti-TUB / Tubby protein homolog antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
