ARG41971

anti-Talin 2 antibody

anti-Talin 2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes Talin 2
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Talin 2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 1787-1822 of Human Talin 2. (NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV)
Conjugation Un-conjugated
Alternate Names Talin-2; ILWEQ

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 70549 Mouse TLN2

GeneID: 83660 Human TLN2

Swiss-port # Q71LX4 Mouse Talin-2

Swiss-port # Q9Y4G6 Human Talin-2

Gene Symbol TLN2
Gene Full Name talin 2
Background This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. This protein has a different pattern of expression compared to talin 1 but, like talin 1, is thought to associate with unique transmembrane receptors to form novel linkages between extracellular matrices and the actin cytoskeleton. [provided by RefSeq, Jul 2008]
Function As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity (By similarity). [UniProt]
Cellular Localization Cytoplasm. Cell junction, focal adhesion. Cell junction, synapse. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Note=Focal adhesion plaques and synapses (PubMed:12422219). [UniProt]
Calculated MW 272 kDa

Images (4) Click the Picture to Zoom In

  • ARG41971 anti-Talin 2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Mouse intestine tissue stained with ARG41971 anti-Talin 2 antibody at 1 µg/ml dilution.

  • ARG41971 anti-Talin 2 antibody WB image

    Western blot: Rat brain, Mouse cardiac muscle and SMMC-7721 whole cell lysates stained with ARG41971 anti-Talin 2 antibody at 0.5 µg/ml dilution.

  • ARG41971 anti-Talin 2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human intestinal cancer tissue stained with ARG41971 anti-Talin 2 antibody at 1 µg/ml dilution.

  • ARG41971 anti-Talin 2 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Rat intestine tissue stained with ARG41971 anti-Talin 2 antibody at 1 µg/ml dilution.