ARG59228
anti-UBA1 / UBE1 antibody
anti-UBA1 / UBE1 antibody for Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes UBA1 / UBE1 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Bov, Hrs, Mk, Rb |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | UBA1 / UBE1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 102-139 of Human UBA1. (HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN) |
| Conjugation | Un-conjugated |
| Alternate Names | UBE1; UBE1X; CFAP124; POC20; UBA1A; GXP1; A1S9; A1S9T; Ubiquitin-activating enzyme E1; Ubiquitin-like modifier-activating enzyme 1; Protein A1S9; SMAX2; AMCX1; A1ST |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | UBA1 |
| Gene Full Name | ubiquitin-like modifier activating enzyme 1 |
| Background | The protein encoded by this gene catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11.23. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq, Jul 2008] |
| Function | Catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation through the ubiquitin-proteasome system. Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a ubiquitin-E1 thioester and free AMP. Essential for the formation of radiation-induced foci, timely DNA repair and for response to replication stress. Promotes the recruitment of TP53BP1 and BRCA1 at DNA damage sites. [UniProt] |
| Cellular Localization | Cytoplasm. Mitochondrion. Nucleus. Isoform 1: Nucleus. Isoform 2: Cytoplasm. [UniProt] |
| Calculated MW | 118 kDa |
| PTM | ISGylated. [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG59228 anti-UBA1 / UBE1 antibody WB image
Western blot: Rat liver, Mouse liver, Mouse testis and HeLa whole cell lysate stained with ARG59228 anti-UBA1 / UBE1 antibody at 0.5 µg/ml dilution.
