ARG41967

anti-UCP2 antibody

anti-UCP2 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes UCP2
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name UCP2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 134-170 of Human UCP2. (AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE)
Conjugation Un-conjugated
Alternate Names UCPH; Solute carrier family 25 member 8; SLC25A8; BMIQ4; Mitochondrial uncoupling protein 2; UCP 2

Application Instructions

Application Suggestion
Tested Application Dilution
WB1:500 - 1:2000
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 34 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 22228 Mouse UCP2

GeneID: 54315 Rat UCP2

GeneID: 7351 Human UCP2

Gene Symbol UCP2
Gene Full Name uncoupling protein 2 (mitochondrial, proton carrier)
Background Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'. [provided by RefSeq, Jul 2008]
Function UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. [UniProt]
Cellular Localization Mitochondrion inner membrane; Multi-pass membrane protein. [UniProt]
Calculated MW 33 kDa

Images (1) Click the Picture to Zoom In

  • ARG41967 anti-UCP2 antibody WB image

    Western blot: 50 µg of samples under reducing conditions. Rat spleen, Rat cardiac muscle, Rat brain, Mouse spleen, Mouse cardiac muscle, Mouse brain and HeLa whole cell lysates stained with ARG41967 anti-UCP2 antibody at 0.5 µg/ml dilution, overnight at 4°C.