ARG58938
anti-UTS2R / GPR14 antibody
anti-UTS2R / GPR14 antibody for Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes UTS2R / GPR14 |
|---|---|
| Tested Reactivity | Hu |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | UTS2R / GPR14 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide from Human UTS2R / GPR14. (within the following region: WGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRP) |
| Conjugation | Un-conjugated |
| Alternate Names | Urotensin-2 receptor; GPR14; Urotensin II receptor; UR-2-R; UTR; UR-II-R; G-protein coupled receptor 14; UTR2 |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||
| Positive Control | Human fetal heart |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | UTS2R |
| Gene Full Name | urotensin 2 receptor |
| Function | High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system. [UniProt] |
| Cellular Localization | Cell membrane; Multi-pass membrane protein. [UniProt] |
| Calculated MW | 42 kDa |
Images (1) Click the Picture to Zoom In
-
ARG58938 anti-UTS2R / GPR14 antibody WB image
Western blot: Human fetal heart lysate stained with ARG58938 anti-UTS2R / GPR14 antibody at 1 µg/ml dilution.
