ARG59244

anti-Wnt2b antibody

anti-Wnt2b antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes Wnt2b
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Wnt2b
Antigen Species Human
Immunogen Synthetic peptide around the middle region of Human Wnt2b. (within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT)
Conjugation Un-conjugated
Alternate Names Protein Wnt-13; WNT13; Protein Wnt-2b

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Application Suggestion
Tested Application Dilution
IHC-P4 - 8 µg/ml
WB1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control HepG2
Observed Size 37 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 7482 Human WNT2B

Swiss-port # Q93097 Human Protein Wnt-2b

Gene Symbol WNT2B
Gene Full Name wingless-type MMTV integration site family, member 2B
Background This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
Function Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. May be involved in normal development or differentiation as well as in carcinogenesis. [UniProt]
Cellular Localization Secreted, extracellular space, extracellular matrix. Secreted. [UniProt]
Calculated MW 44 kDa
PTM Palmitoleylation is required for efficient binding to frizzled receptors. Depalmitoleylation leads to Wnt signaling pathway inhibition. [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG59244 anti-Wnt2b antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung stained with ARG59244 anti-Wnt2b antibody at 4.0 - 8.0 µg/ml dilution. Magnification: 400X.

  • ARG59244 anti-Wnt2b antibody WB image

    Western blot: HepG2 cell lysate stained with ARG59244 anti-Wnt2b antibody at 1.0 µg/ml dilution.