ARG41698

anti-Wnt7b antibody

anti-Wnt7b antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse

Overview

Product Description Rabbit Polyclonal antibody recognizes Wnt7b
Tested Reactivity Hu, Ms
Predict Reactivity Cow, Rat, Dog, Gpig, Hrs, Pig
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Wnt7b
Antigen Species Human
Immunogen Synthetic peptide around the middle region of Human Wnt7b. (within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM)
Conjugation Un-conjugated
Alternate Names Protein Wnt-7b

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 86%; Horse: 100%; Pig: 100%; Rat: 100%
Application Suggestion
Tested Application Dilution
IHC-P5 µg/ml
WB1 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was recommended.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control MCF7
Observed Size ~ 36 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 22422 Mouse WNT7B

GeneID: 7477 Human WNT7B

Swiss-port # P28047 Mouse Protein Wnt-7b

Swiss-port # P56706 Human Protein Wnt-7b

Gene Symbol WNT7B
Gene Full Name wingless-type MMTV integration site family, member 7B
Background This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Among members of the human WNT family, this gene product is most similar to WNT7A protein. [provided by RefSeq, Oct 2008]
Function Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters (By similarity). [UniProt]
Cellular Localization Secreted, extracellular space, extracellular matrix. Secreted. [UniProt]
Calculated MW 39 kDa
PTM Palmitoleylation is required for efficient binding to frizzled receptors. Depalmitoleylation leads to Wnt signaling pathway inhibition. [UniProt]

Images (3) Click the Picture to Zoom In

  • ARG41698 anti-Wnt7b antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and paraffin-embedded Human cerebral cortex tissue. Antigen Retrieval: Heat mediation was recommended. The tissue section was stained with ARG41698 anti-Wnt7b antibody at 5 µg/ml dilution.

  • ARG41698 anti-Wnt7b antibody WB image

    Western blot: MCF7 cell lysate stained with ARG41698 anti-Wnt7b antibody at 1 µg/ml dilution.

  • ARG41698 anti-Wnt7b antibody WB image

    Western blot: Mouse spleen lysate stained with ARG41698 anti-Wnt7b antibody at 1 µg/ml dilution.