ARG41259

anti-ZNF264 antibody

anti-ZNF264 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes ZNF264
Tested Reactivity Hu
Predict Reactivity Cow, Rat, Dog, Hrs, Rb
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ZNF264
Antigen Species Human
Immunogen Synthetic peptide around the C-terminal region of Human ZNF264. (within the following region: SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL)
Conjugation Un-conjugated
Alternate Names Zinc finger protein 264

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 86%; Dog: 79%; Horse: 86%; Rabbit: 79%; Rat: 79%
Application Suggestion
Tested Application Dilution
IHC-P4 - 8 µg/ml
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Jurkat
Observed Size 70 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 9422 Human ZNF264

Swiss-port # O43296 Human Zinc finger protein 264

Gene Symbol ZNF264
Gene Full Name zinc finger protein 264
Background This gene encodes a zinc finger protein and belongs to the krueppel C2H2-type zinc-finger protein family. Zinc finger proteins are often localized in the nucleus, bind nucleic acids, and regulate transcription. [provided by RefSeq, Jan 2010]
Function May be involved in transcriptional regulation. [UniProt]
Cellular Localization Nucleus. [UniProt]
Calculated MW 71 kDa

Images (2) Click the Picture to Zoom In

  • ARG41259 anti-ZNF264 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human lung tissue stained with ARG41259 anti-ZNF264 antibody at 4 - 8 µg/ml dilution.

  • ARG41259 anti-ZNF264 antibody WB image

    Western blot: Jurkat cell lysate stained with ARG41259 anti-ZNF264 antibody at 0.2 - 1 µg/ml dilution.