ARG40285
anti-alpha Actinin 3 antibody [9B5]
anti-alpha Actinin 3 antibody [9B5] for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Mouse Monoclonal antibody [9B5] recognizes alpha Actinin 3 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Tested Application | IHC-P, WB |
| Host | Mouse |
| Clonality | Monoclonal |
| Clone | 9B5 |
| Isotype | IgG1 |
| Target Name | alpha Actinin 3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 574-617 of Human alpha Actinin 3. (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK) |
| Conjugation | Un-conjugated |
| Alternate Names | Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; Alpha-actinin-3 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Observed Size | ~ 100 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 4% Trehalose |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | ACTN3 |
| Gene Full Name | actinin, alpha 3 (gene/pseudogene) |
| Background | This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. [provided by RefSeq, Feb 2014] |
| Function | F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. [UniProt] |
| Calculated MW | 103 kDa |
Images (2) Click the Picture to Zoom In
-
ARG40285 anti-alpha Actinin 3 antibody [9B5] IHC-P image
Immunohistochemistry: Paraffin-embedded Human skeletal muscle tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG40285 anti-alpha Actinin 3 antibody [9B5] at 1 µg/ml, overnight at 4°C.
-
ARG40285 anti-alpha Actinin 3 antibody [9B5] WB image
Western blot: 50 µg of samples under reducing conditions. Rat skeletal muscle and Mouse skeletal muscle lysates stained with ARG40285 anti-alpha Actinin 3 antibody [9B5] at 0.5 µg/ml, overnight at 4°C.
