ARG59459

anti-alpha Parvin antibody

anti-alpha Parvin antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes alpha Parvin
Tested Reactivity Hu, Ms, Rat
Predict Reactivity Hm
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name alpha Parvin
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 155-185 of Human alpha Parvin. (QKLQTVLEKINETLKLPPRSIKWNVDSVHAK)
Conjugation Un-conjugated
Alternate Names Calponin-like integrin-linked kinase-binding protein; Actopaxin; Alpha-parvin; CH-ILKBP; MXRA2; Matrix-remodeling-associated protein 2

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 55742 Human PARVA

GeneID: 57341 Rat PARVA

GeneID: 57342 Mouse PARVA

Gene Symbol PARVA
Gene Full Name parvin, alpha
Background This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival. [provided by RefSeq, Dec 2010]
Function Plays a role in sarcomere organization and in smooth muscle cell contraction. Required for normal development of the embryonic cardiovascular system, and for normal septation of the heart outflow tract. Plays a role in sprouting angiogenesis and is required for normal adhesion of vascular smooth muscle cells to endothelial cells during blood vessel development (By similarity). Plays a role in the reorganization of the actin cytoskeleton, formation of lamellipodia and ciliogenesis. Plays a role in the establishement of cell polarity, cell adhesion, cell spreading, and directed cell migration. [UniProt]
Cellular Localization Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton. Cytoplasm, myofibril, sarcomere, Z line. Note=Constituent of focal adhesions. Associates with the actin cytoskeleton. [UniProt]
Calculated MW 42 kDa

Images (2) Click the Picture to Zoom In

  • ARG59459 anti-alpha Parvin antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human mammary cancer stained with ARG59459 anti-alpha Parvin antibody.

  • ARG59459 anti-alpha Parvin antibody WB image

    Western blot: 50 µg of Rat liver, 40 µg of HeLa, 40 µg of SW620 and 40 µg of HEPA stained with ARG59459 anti-alpha Parvin antibody at 0.5 µg/ml dilution.