ARG58700

anti-ADAM2 antibody

anti-ADAM2 antibody for Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes ADAM2
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ADAM2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 231-274 of Human ADAM2 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK).
Conjugation Un-conjugated
Alternate Names PH30-beta; Disintegrin and metalloproteinase domain-containing protein 2; CT15; PH30; PH-30; PH-30b; Fertilin subunit beta; ADAM 2; Cancer/testis antigen 15; FTNB; CRYN2; CRYN1

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 11495 Mouse ADAM2

GeneID: 2515 Human ADAM2

GeneID: 56806 Rat ADAM2

Gene Symbol ADAM2
Gene Full Name ADAM metallopeptidase domain 2
Background This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded protein is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
Function Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein. [UniProt]
Cellular Localization Membrane; Single-pass type I membrane protein. [UniProt]
Calculated MW 82 kDa
PTM The prodomain and the metalloprotease domain are cleaved during the epididymal maturation of the spermatozoa. [UniProt]