ARG58700
anti-ADAM2 antibody
anti-ADAM2 antibody for Western blot and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes ADAM2 |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | ADAM2 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 231-274 of Human ADAM2 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK). |
Conjugation | Un-conjugated |
Alternate Names | PH30-beta; Disintegrin and metalloproteinase domain-containing protein 2; CT15; PH30; PH-30; PH-30b; Fertilin subunit beta; ADAM 2; Cancer/testis antigen 15; FTNB; CRYN2; CRYN1 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | ADAM2 |
Gene Full Name | ADAM metallopeptidase domain 2 |
Background | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded protein is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
Function | Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein. [UniProt] |
Cellular Localization | Membrane; Single-pass type I membrane protein. [UniProt] |
Calculated MW | 82 kDa |
PTM | The prodomain and the metalloprotease domain are cleaved during the epididymal maturation of the spermatozoa. [UniProt] |