ARG58306

anti-ALDH7A1 antibody

anti-ALDH7A1 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes ALDH7A1
Tested Reactivity Hu, Rat
Tested Application FACS, ICC/IF, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ALDH7A1
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence at the C-terminus of Human ALDH7A1 (333-369aa ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY), different from the related Mouse sequence by eight amino acids, and from the related Rat sequence by six amino acids.
Conjugation Un-conjugated
Alternate Names Alpha-AASA dehydrogenase; P6c dehydrogenase; Alpha-aminoadipic semialdehyde dehydrogenase; Antiquitin-1; ATQ1; EC 1.2.1.8; Delta1-piperideine-6-carboxylate dehydrogenase; Betaine aldehyde dehydrogenase; Aldehyde dehydrogenase family 7 member A1; EC 1.2.1.31; EPD; PDE; EC 1.2.1.3

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC/IF1:200 - 1:1000
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 291450 Rat ALDH7A1

GeneID: 501 Human ALDH7A1

Swiss-port # P49419 Human Alpha-aminoadipic semialdehyde dehydrogenase

Swiss-port # Q64057 Rat Alpha-aminoadipic semialdehyde dehydrogenase

Gene Symbol ALDH7A1
Gene Full Name aldehyde dehydrogenase 7 family, member A1
Background The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified. [provided by RefSeq, Jan 2011]
Function Multifunctional enzyme mediating important protective effects. Metabolizes betaine aldehyde to betaine, an important cellular osmolyte and methyl donor. Protects cells from oxidative stress by metabolizing a number of lipid peroxidation-derived aldehydes. Involved in lysine catabolism. [UniProt]
Cellular Localization Cytoplasm, cytosol. Nucleus. [UniProt]
Calculated MW 58 kDa