ARG40208
anti-AMACR / p504S antibody
anti-AMACR / p504S antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes AMACR / p504S |
|---|---|
| Tested Reactivity | Hu, Rat |
| Predict Reactivity | Bov, Hrs, Mk |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | AMACR / p504S |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 208-246 of Human AMACR / p504S. (RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK) |
| Conjugation | Un-conjugated |
| Alternate Names | CBAS4; RACE; RM; EC 5.1.99.4; Alpha-methylacyl-CoA racemase; AMACRD; 2-methylacyl-CoA racemase |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | AMACR |
| Gene Full Name | alpha-methylacyl-CoA racemase |
| Background | This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. [provided by RefSeq, Mar 2011] |
| Function | Racemization of 2-methyl-branched fatty acid CoA esters. Responsible for the conversion of pristanoyl-CoA and C27-bile acyl-CoAs to their (S)-stereoisomers. [UniProt] |
| Cellular Localization | Peroxisome. Mitochondrion. [UniProt] |
| Calculated MW | 42 kDa |
