ARG22461

anti-AMH antibody [5/6]

anti-AMH antibody [5/6] for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Sheep,Monkey,Baboon

Overview

Product Description Mouse Monoclonal antibody [5/6] recognizes AMH
This antibody recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140 kDa disulphide linked precursor that is cleaved to release the mature 30 kDa homodimer.
Tested Reactivity Hu, Ms, Bb, Mk, Sheep
Tested Application IHC-P, WB
Host Mouse
Clonality Monoclonal
Clone 5/6
Isotype IgG1
Target Name AMH
Antigen Species Human
Immunogen Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Conjugation Un-conjugated
Alternate Names AMH; Muellerian-inhibiting substance; MIF; Anti-Muellerian hormone; Muellerian-inhibiting factor; MIS

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:20 - 1:40
WBAssay-dependent
Application Note IHC-P: This product requires antigen retrieval using heat treatment prior to staining of paraffin sections.Sodium citrate buffer pH 6.0 is recommended for this purpose.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Tissue Culture Supernatant
Buffer Tissue Culture Supernatant and 0.1% Sodium azide.
Preservative 0.1% Sodium azide
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 268 Human AMH

Swiss-port # P03971 Human Muellerian-inhibiting factor

Gene Symbol AMH
Gene Full Name anti-Mullerian hormone
Background Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2008]
Function This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. [UniProt]
Calculated MW 59 kDa