ARG59313

anti-ANGPTL2 antibody

anti-ANGPTL2 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes ANGPTL2
Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ANGPTL2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 275-312 of Human ANGPTL2. (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD)
Conjugation Un-conjugated
Alternate Names Angiopoietin-related protein 2; Angiopoietin-like protein 2; HARP; ARP2

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: By heat mediation.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 23452 Human ANGPTL2

GeneID: 26360 Mouse ANGPTL2

Swiss-port # Q9R045 Mouse Angiopoietin-related protein 2

Swiss-port # Q9UKU9 Human Angiopoietin-related protein 2

Gene Symbol ANGPTL2
Gene Full Name angiopoietin-like 2
Background Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action. [provided by RefSeq, Jul 2008]
Function Induces sprouting in endothelial cells through an autocrine and paracrine action. [UniProt]
Cellular Localization Secreted. [UniProt]
Calculated MW 57 kDa
PTM N-glycosylated. [UniProt]