ARG59029
anti-ARHGEF1 antibody
anti-ARHGEF1 antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes ARHGEF1 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Hm |
| Tested Application | FACS, ICC/IF, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | ARHGEF1 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 41-71 of Human ARHGEF1 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE). |
| Conjugation | Un-conjugated |
| Alternate Names | p115RhoGEF; LSC; SUB1.5; Sub1.5; LBCL2; Rho guanine nucleotide exchange factor 1; P115-RHOGEF; 115 kDa guanine nucleotide exchange factor; p115-RhoGEF; GEF1 |
Application Instructions
| Application Suggestion |
|
||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q61210 Mouse Rho guanine nucleotide exchange factor 1 Swiss-port # Q92888 Human Rho guanine nucleotide exchange factor 1 |
|---|---|
| Gene Symbol | ARHGEF1 |
| Gene Full Name | Rho guanine nucleotide exchange factor (GEF) 1 |
| Background | Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2008] |
| Function | Seems to play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13) subunits. Acts as GTPase-activating protein (GAP) for GNA12 and GNA13, and as guanine nucleotide exchange factor (GEF) for RhoA GTPase. Activated G alpha 13/GNA13 stimulates the RhoGEF activity through interaction with the RGS-like domain. This GEF activity is inhibited by binding to activated GNA12. Mediates angiotensin-2-induced RhoA activation. [UniProt] |
| Cellular Localization | Cytoplasm. Membrane. Translocated to the membrane by activated GNA13 or LPA stimulation. [UniProt] |
| Calculated MW | 102 kDa |
| PTM | Phosphorylated by PKCA. Angiotensin-2 induced Tyr-738 phosphorylation is mediated by JAK2. [UniProt] |
