ARG59071

anti-ATG14 / ATG14L antibody

anti-ATG14 / ATG14L antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes ATG14 / ATG14L
Tested Reactivity Hu, Rat
Predict Reactivity Hm
Tested Application FACS, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name ATG14 / ATG14L
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 70-101 of Human ATG14 / ATG14L (RDRERFIDKKERLSRLKSKQEEFQKEVLKAME).
Conjugation Un-conjugated
Alternate Names BARKOR; Autophagy-related protein 14-like protein; Beclin 1-associated autophagy-related key regulator; Barkor; KIAA0831; Atg14L; ATG14L

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1 - 3 µg/10^6 cells
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 57 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 22863 Human ATG14

GeneID: 305831 Rat ATG14

Swiss-port # D4A4K3 Rat Beclin 1-associated autophagy-related key regulator

Swiss-port # Q6ZNE5 Human Beclin 1-associated autophagy-related key regulator

Gene Symbol ATG14
Gene Full Name autophagy related 14
Function Required for both basal and inducible autophagy. Determines the localization of the autophagy-specific PI3-kinase complex PI3KC3-C1. Plays a role in autophagosome formation and MAP1LC3/LC3 conjugation to phosphatidylethanolamine. Promotes BECN1 translocation from the trans-Golgi network to autophagosomes. Enhances PIK3C3 activity in a BECN1-dependent manner. Essential for the autophagy-dependent phosphorylation of BECN1. Stimulates the phosphorylation of BECN1, but suppresses the phosphorylation PIK3C3 by AMPK. Binds to STX17-SNAP29 binary t-SNARE complex on autophagosomes and primes it for VAMP8 interaction to promote autophagosome-endolysosome fusion. Modulates the hepatic lipid metabolism (By similarity). [UniProt]
Cellular Localization Cytoplasm. Endoplasmic reticulum membrane; Peripheral membrane protein. Preautophagosomal structure membrane; Peripheral membrane protein. Cytoplasmic vesicle, autophagosome membrane; Peripheral membrane protein. [UniProt]
Calculated MW 55 kDa