ARG40567
anti-Aquaporin 2 antibody
anti-Aquaporin 2 antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Aquaporin 2 |
|---|---|
| Tested Reactivity | Hu, Ms, Rat |
| Predict Reactivity | Hm |
| Tested Application | FACS, IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Aquaporin 2 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 241-271 of Human Aquaporin 2. (EPDTDWEEREVRRRQSVELHSPQSLPRGTKA) |
| Conjugation | Un-conjugated |
| Alternate Names | Aquaporin-2; Aquaporin-CD; AQP-2; ADH water channel; Collecting duct water channel protein; Water channel protein for renal collecting duct; AQP-CD; WCH-CD |
Application Instructions
| Application Suggestion |
|
||||||||
|---|---|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | AQP2 |
| Gene Full Name | aquaporin 2 (collecting duct) |
| Background | This gene encodes a water channel protein located in the kidney collecting tubule. It belongs to the MIP/aquaporin family, some members of which are clustered together on chromosome 12q13. Mutations in this gene have been linked to autosomal dominant and recessive forms of nephrogenic diabetes insipidus. [provided by RefSeq, Oct 2008] |
| Function | Forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. [UniProt] |
| Cellular Localization | Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Note=Shuttles from vesicles to the apical membrane. Vasopressin-regulated phosphorylation is required for translocation to the apical cell membrane. PLEKHA8/FAPP2 is required to transport AQP2 from the TGN to sites where AQP2 is phosphorylated. [UniProt] |
| Calculated MW | 29 kDa |
| PTM | Ser-256 phosphorylation is necessary and sufficient for expression at the apical membrane. Endocytosis is not phosphorylation-dependent. [UniProt] |
