ARG41570

anti-Aryl Hydrocarbon Receptor antibody

anti-Aryl Hydrocarbon Receptor antibody for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes Aryl Hydrocarbon Receptor
Tested Reactivity Hu, Ms, Rat
Tested Application FACS, IHC-P
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Aryl Hydrocarbon Receptor
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human Aryl Hydrocarbon Receptor. (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH)
Conjugation Un-conjugated
Alternate Names Aryl hydrocarbon receptor; AhR; Ah receptor; bHLHe76; Class E basic helix-loop-helix protein 76

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
IHC-P1:200 - 1:1000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 11622 Mouse AHR

GeneID: 196 Human AHR

GeneID: 25690 Rat AHR

Gene Symbol AHR
Gene Full Name aryl hydrocarbon receptor
Background The protein encoded by this gene is a ligand-activated helix-loop-helix transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Before ligand binding, the encoded protein is sequestered in the cytoplasm; upon ligand binding, this protein moves to the nucleus and stimulates transcription of target genes. [provided by RefSeq, Sep 2015]
Function Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of PER1. [UniProt]
Cellular Localization Cytoplasm. Nucleus. Note=Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus. [UniProt]
Calculated MW 96 kDa