ARG42741

anti-B3GNT8 antibody

anti-B3GNT8 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes B3GNT8
Tested Reactivity Hu
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name B3GNT8
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 360-397 of Human B3GNT8. (ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC)
Conjugation Un-conjugated
Alternate Names Beta-1,3-N-acetylglucosaminyltransferase 8; BGnT-8; B3GALT7; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8; EC 2.4.1.-; Beta3Gn-T8; Beta-1,3-Gn-T8; beta3Gn-T8; BGALT15

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 45 kDa

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 374907 Human B3GNT8

Swiss-port # Q7Z7M8 Human UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8

Gene Symbol B3GNT8
Gene Full Name UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
Function Beta-1,3-N-acetylglucosaminyltransferase that plays a role in the elongation of specific branch structures of multiantennary N-glycans. Has strong activity towards tetraantennary N-glycans and 2,6 triantennary glycans. [UniProt]
Cellular Localization Golgi apparatus membrane; Single-pass type II membrane protein. [UniProt]
Calculated MW 43 kDa