ARG40847

anti-C Reactive Protein antibody

anti-C Reactive Protein antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human,Mouse

Overview

Product Description Rabbit Polyclonal antibody recognizes C Reactive Protein
Tested Reactivity Hu, Ms
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name C Reactive Protein
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human CRP. (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA)
Conjugation Un-conjugated
Alternate Names 1-205; PTX1; C-reactive protein

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P1:200 - 1:1000
WB1:500 - 1:2000
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 12944 Mouse CRP

GeneID: 1401 Human CRP

Swiss-port # P02741 Human C-reactive protein

Swiss-port # P14847 Mouse C-reactive protein

Gene Symbol CRP
Gene Full Name C-reactive protein, pentraxin-related
Background The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognize foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli. [provided by RefSeq, Sep 2009]
Function Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. [UniProt]
Cellular Localization Secreted. [UniProt]
Calculated MW 25 kDa