ARG40196

anti-CD105 / Endoglin antibody

anti-CD105 / Endoglin antibody for Western blot and Human,Mouse,Rat

publication_link Publication1

Overview

Product Description Rabbit Polyclonal antibody recognizes CD105 / Endoglin
Tested Reactivity Hu, Ms, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CD105 / Endoglin
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 258-297 of Human CD105 / Endoglin. (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ)
Conjugation Un-conjugated
Alternate Names CD antigen CD105; HHT1; Endoglin; ORW1; END

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 13805 Mouse ENG

GeneID: 2022 Human ENG

Swiss-port # P17813 Human Endoglin

Swiss-port # Q63961 Mouse Endoglin

Gene Symbol ENG
Gene Full Name endoglin
Background This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2013]
Function Major glycoprotein of vascular endothelium. Involved in the regulation of angiogenesis. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. Acts as TGF-beta coreceptor and is involved in the TGF-beta/BMP signaling cascade. Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGF-beta1 signaling through SMAD3. [UniProt]
Cellular Localization Cell membrane; Single-pass type I membrane protein. [UniProt]
Calculated MW 71 kDa

Specific References

Increased cGAS/STING signaling components in patients with Mooren's ulcer

WB / Human

Ya-Ni Zhang et al.
Int J Ophthalmol.,  (2021)

publication_link

 

hr_line