ARG59658

anti-CD193 / CCR3 antibody

anti-CD193 / CCR3 antibody for Western blot,Flow cytometry and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes CD193 / CCR3
Tested Reactivity Hu, Ms, Rat
Tested Application FACS, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CD193 / CCR3
Antigen Species Human
Immunogen Synthetic peptide corresponding to a sequence of Human CCR3. (MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA)
Conjugation Un-conjugated
Alternate Names C-C chemokine receptor type 3; CD193; CKR3; CCR-3; Eosinophil eotaxin receptor; CMKBR3; C-C CKR-3; CCR3; CC-CKR-3; CD antigen CD193

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1 - 3 µg/10^6 cells
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 117027 Rat CCR3

GeneID: 1232 Human CCR3

GeneID: 12771 Mouse CCR3

Gene Symbol CCR3
Gene Full Name chemokine (C-C motif) receptor 3
Background The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. Alternatively spliced transcript variants have been described. [provided by RefSeq, Sep 2009]
Function Receptor for a C-C type chemokine. Binds to eotaxin, eotaxin-3, MCP-3, MCP-4, RANTES and MIP-1 delta. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection. [UniProt]
Cellular Localization Cell membrane; Multi-pass membrane protein. [UniProt]
Calculated MW 41 kDa