ARG41640
anti-CD272 / BTLA antibody
anti-CD272 / BTLA antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections,Flow cytometry and Human,Mouse
Overview
Product Description | Rabbit Polyclonal antibody recognizes CD272 / BTLA |
---|---|
Tested Reactivity | Hu, Ms |
Tested Application | FACS, IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | CD272 / BTLA |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to a sequence of Human CD272 / BTLA. (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL) |
Conjugation | Un-conjugated |
Alternate Names | CD antigen CD272; BTLA1; B- and T-lymphocyte-associated protein; B- and T-lymphocyte attenuator; CD272 |
Application Instructions
Application Suggestion |
|
||||||||
---|---|---|---|---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||||
Observed Size | ~ 33 kDa (nonglycosylated); ~ 65 kDa (glycosylated) |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
Preservative | 0.05% Sodium azide |
Stabilizer | 4% Trehalose |
Concentration | 0.5 - 1 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | BTLA |
Gene Full Name | B and T lymphocyte associated |
Background | This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011] |
Function | Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response. [UniProt] |
Cellular Localization | Membrane; Single-pass type I membrane protein. [UniProt] |
Calculated MW | 33 kDa |
PTM | Phosphorylated on Tyr residues by TNFRSF14 and by antigen receptors cross-linking, both inducing association with PTPN6 and PTPN11. N-glycosylated. [UniProt] |