ARG42600

anti-CREB3L2 / BBF2H7 antibody

anti-CREB3L2 / BBF2H7 antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes CREB3L2 / BBF2H7
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CREB3L2 / BBF2H7
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human CREB3L2 / BBF2H7. (within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF)
Conjugation Un-conjugated
Alternate Names Cyclic AMP-responsive element-binding protein 3-like protein 2; BBF2 human homolog on chromosome 7; BBF2H7; cAMP-responsive element-binding protein 3-like protein 2

Application Instructions

Predict Reactivity Note Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 85%; Guinea pig: 87%; Horse: 87%; Mouse: 86%; Rabbit: 87%; Rat: 87%
Application Suggestion
Tested Application Dilution
IHC-PAssay-dependent
WB1 - 5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Jurkat, Human fetal muscle, lung, heart and brain.
Observed Size ~ 52 kDa

Properties

Form Liquid
Purification Purification with Protein A.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 64764 Human CREB3L2

Swiss-port # Q70SY1 Human Cyclic AMP-responsive element-binding protein 3-like protein 2

Gene Symbol CREB3L2
Gene Full Name cAMP responsive element binding protein 3-like 2
Background This gene encodes a member of the oasis bZIP transcription factor family. Members of this family can dimerize but form homodimers only. The encoded protein is a transcriptional activator. Translocations between this gene on chromosome 7 and the gene fused in sarcoma on chromosome 16 can be found in some tumors. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Function Transcription factor involved in unfolded protein response (UPR). In the absence of endoplasmic reticulum (ER) stress, inserted into ER membranes, with N-terminal DNA-binding and transcription activation domains oriented toward the cytosolic face of the membrane. In response to ER stress, transported to the Golgi, where it is cleaved in a site-specific manner by resident proteases S1P/MBTPS1 and S2P/MBTPS2. The released N-terminal cytosolic domain is translocated to the nucleus to effect transcription of specific target genes. Plays a critical role in chondrogenesis by activating the transcription of SEC23A, which promotes the transport and secretion of cartilage matrix proteins, and possibly that of ER biogenesis-related genes (By similarity). In a neuroblastoma cell line, protects cells from ER stress-induced death (PubMed:17178827). In vitro activates transcription of target genes via direct binding to the CRE site (PubMed:17178827). [UniProt]
Cellular Localization Endoplasmic reticulum membrane; Single-pass type II membrane protein. Note=ER membrane resident protein. Upon ER stress, translocated to the Golgi apparatus where it is cleaved. The cytosolic N-terminal fragment (processed cyclic AMP-responsive element-binding protein 3-like protein 1) is transported into the nucleus. Processed cyclic AMP-responsive element-binding protein 3-like protein 2: Nucleus. Note=Upon ER stress, translocated into the nucleus. [UniProt]
Calculated MW 57 kDa
PTM Upon ER stress, translocated to the Golgi apparatus, where it is processed by regulated intramembrane proteolysis (RIP) to release the cytosol-facing N-terminal transcription factor domain. The cleavage is performed sequentially by site-1 and site-2 proteases (S1P/MBTPS1 and S2P/MBTPS2).

N-glycosylated.

Ubiquitinated by HRD1/SYVN1; undergoes 'Lys-48'-linked ubiquitination, followed by rapid proteasomal degradation under normal conditions. Upon ER stress, SYVN1 E3 ubiquitin-protein ligase dissociates from its substrate, ubiquitination does not occur and CREB3L2 is stabilized. [UniProt]