ARG40152

anti-CRISPLD2 antibody

anti-CRISPLD2 antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes CRISPLD2
Tested Reactivity Hu
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CRISPLD2
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human CRISPLD2. (within the following region: MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA)
Conjugation Un-conjugated
Alternate Names CRISP11; CRISP-11; LCCL domain-containing cysteine-rich secretory protein 2; LCRISP2; Cysteine-rich secretory protein LCCL domain-containing 2; Cysteine-rich secretory protein 11

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Jurkat

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 83716 Human CRISPLD2

Swiss-port # Q9H0B8 Human Cysteine-rich secretory protein LCCL domain-containing 2

Gene Symbol CRISPLD2
Gene Full Name cysteine-rich secretory protein LCCL domain containing 2
Function Promotes matrix assembly. [UniProt]
Cellular Localization Secreted. [UniProt]
Calculated MW 56 kDa