ARG41306

anti-CSRP3 antibody

anti-CSRP3 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes CSRP3
Tested Reactivity Hu, Rat
Predict Reactivity Ms, Cow, Dog, Gpig, Hrs, Rb
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name CSRP3
Antigen Species Human
Immunogen Synthetic peptide around the middle region of Human CSRP3. (within the following region: QGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCG)
Conjugation Un-conjugated
Alternate Names CMH12; LIM domain protein, cardiac; Cysteine and glycine-rich protein 3; LMO4; Muscle LIM protein; MLP; CMD1M; CRP3; Cysteine-rich protein 3; Cardiac LIM protein; CLP

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%
Application Suggestion
Tested Application Dilution
WB0.2 - 1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control Human heart

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 117505 Rat CSRP3

GeneID: 8048 Human CSRP3

Swiss-port # P50461 Human Cysteine and glycine-rich protein 3

Swiss-port # P50463 Rat Cysteine and glycine-rich protein 3

Gene Symbol CSRP3
Gene Full Name cysteine and glycine-rich protein 3 (cardiac LIM protein)
Background This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]
Function Positive regulator of myogenesis. Plays a crucial and specific role in the organization of cytosolic structures in cardiomyocytes. Could play a role in mechanical stretch sensing. May be a scaffold protein that promotes the assembly of interacting proteins at Z-line structures. It is essential for calcineurin anchorage to the Z line. Required for stress-induced calcineurin-NFAT activation (By similarity). [UniProt]
Cellular Localization Nucleus. Cytoplasm. Cytoplasm, cytoskeleton. Cytoplasm, myofibril, sarcomere, Z line. Cytoplasm, myofibril, sarcomere. Note=Nucleocytoplasmic shuttling protein. Mainly cytoplasmic. In the Z line, found associated with GLRX3 (By similarity). Isoform 2: Cytoplasm, myofibril, sarcomere, Z line. [UniProt]
Calculated MW 21 kDa
PTM Phosphorylated by PKC/PRKCA. [UniProt]