ARG40368
anti-Cytokeratin 5 antibody
anti-Cytokeratin 5 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Cytokeratin 5 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Cytokeratin 5 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 286-317 of Human Cytokeratin 5. (KVELEAKVDALMDEINFMKMFFDAELSQMQTH) |
| Conjugation | Un-conjugated |
| Alternate Names | DDD1; 58 kDa cytokeratin; Keratin, type II cytoskeletal 5; EBS2; Keratin-5; Cytokeratin-5; CK5; KRT5A; K5; CK-5; Type-II keratin Kb5; DDD |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | IHC-P: Antigen Retrieval: By heat mediation. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Observed Size | 62 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | KRT5 |
| Gene Full Name | keratin 5, type II |
| Background | Cytokeratin 5 is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the basal layer of the epidermis with family member KRT14. Mutations in these genes have been associated with a complex of diseases termed epidermolysis bullosa simplex. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq, Jul 2008] |
| Calculated MW | 62 kDa |
