ARG58572

anti-Emerin antibody

anti-Emerin antibody for Flow cytometry,ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes Emerin
Tested Reactivity Hu, Ms, Rat
Tested Application FACS, ICC/IF, IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name Emerin
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 1-48 of Human Emerin. (MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL)
Conjugation Un-conjugated
Alternate Names Emerin; LEMD5; EDMD; STA

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
ICC/IF1:200 - 1:1000
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min, or performed in EDTA buffer (pH 8.0).
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 13726 Mouse EMD

GeneID: 2010 Human EMD

GeneID: 25437 Rat EMD

Gene Symbol EMD
Gene Full Name emerin
Background Emerin is a serine-rich nuclear membrane protein and a member of the nuclear lamina-associated protein family. It mediates membrane anchorage to the cytoskeleton. Dreifuss-Emery muscular dystrophy is an X-linked inherited degenerative myopathy resulting from mutation in the emerin gene. [provided by RefSeq, Jul 2008]
Function Stabilizes and promotes the formation of a nuclear actin cortical network. Stimulates actin polymerization in vitro by binding and stabilizing the pointed end of growing filaments. Inhibits beta-catenin activity by preventing its accumulation in the nucleus. Acts by influencing the nuclear accumulation of beta-catenin through a CRM1-dependent export pathway. Links centrosomes to the nuclear envelope via a microtubule association. EMD and BAF are cooperative cofactors of HIV-1 infection. Association of EMD with the viral DNA requires the presence of BAF and viral integrase. The association of viral DNA with chromatin requires the presence of BAF and EMD. Required for proper localization of non-farnesylated prelamin-A/C. [UniProt]
Cellular Localization Nucleus inner membrane; Single-pass membrane protein; Nucleoplasmic side. Nucleus outer membrane. Colocalized with BANF1 at the central region of the assembling nuclear rim, near spindle-attachment sites. The accumulation of different intermediates of prelamin-A/C (non- farnesylated or carboxymethylated farnesylated prelamin-A/C) in fibroblasts modify its localization in the nucleus. [UniProt]
Calculated MW 29 kDa
PTM Found in four different phosphorylated forms, three of which appear to be associated with the cell cycle. [UniProt]